PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_1FA87027B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 202aa    MW: 22165.2 Da    PI: 11.369
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_1FA87027B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.3e-19853147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           rg+W++eEd  l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Traes_7DL_1FA87027B.1  8 RGPWSPEEDSALRQLVERHGARNWTAIGRGVP-GRSGKSCRLRWCNQ 53
                           89******************************.***********985 PP

2Myb_DNA-binding51.52.4e-1660102145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            r ++T+eEd  +++a+++lG++ W++Iar +  gRt++ +k++w+
  Traes_7DL_1FA87027B.1  60 RRPFTAEEDAVIARAHARLGNR-WAAIARLLR-GRTDNAVKNHWN 102
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.706158IPR017930Myb domain
SuperFamilySSF466891.95E-305101IPR009057Homeodomain-like
SMARTSM007173.1E-16756IPR001005SANT/Myb domain
PfamPF002493.5E-18853IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-24960IPR009057Homeodomain-like
CDDcd001676.27E-151052No hitNo description
SMARTSM007177.0E-1459107IPR001005SANT/Myb domain
PfamPF002497.6E-1460102IPR001005SANT/Myb domain
PROSITE profilePS5129417.37260109IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2161109IPR009057Homeodomain-like
CDDcd001671.85E-1062102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEGCDRIRGP WSPEEDSALR QLVERHGARN WTAIGRGVPG RSGKSCRLRW CNQLSPGVER  60
RPFTAEEDAV IARAHARLGN RWAAIARLLR GRTDNAVKNH WNCSLKRRLG DLGADGVAEG  120
ELEERPCKRA SVTPESTSGX XXXXXXXXXX XXXXXXXXXR VRAGGLRHEP ATRGGGGAGG  180
PIHVALALPP RHGCPWVPLP PR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3851094108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3641591e-136AK364159.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965791.15e-68PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-57MYB44_ARATH; Transcription factor MYB44
TrEMBLW5HXZ61e-122W5HXZ6_WHEAT; Uncharacterized protein
STRINGMLOC_63964.17e-81(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-58myb domain protein r1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]